PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00076.41
Common NameAMTR_s00076p00127530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 200aa    MW: 21808.3 Da    PI: 8.1605
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00076.41genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.41.4e-3912109198
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearar 70 
                                              +Ca+Ck+lrr+C+kdC++ pyfpa++p+kfa vh++FGasnv+k+l+++p ++r da+ s+vyeA+ar++
  evm_27.model.AmTr_v1.0_scaffold00076.41  12 PCAGCKLLRRRCTKDCIFVPYFPATDPEKFAGVHRIFGASNVSKMLRDIPVNQRGDAVCSMVYEAHARLK 81 
                                              7********************************************************************* PP

                                   DUF260  71 dPvyGavgvilklqqqleqlkaelallk 98 
                                              dP+yG+v+ i +lq+q++ l+aela+++
  evm_27.model.AmTr_v1.0_scaffold00076.41  82 DPIYGCVAAIVSLQHQVSILQAELAMTN 109
                                              ************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.27311112IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4012109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MKSCSRMKIK MPCAGCKLLR RRCTKDCIFV PYFPATDPEK FAGVHRIFGA SNVSKMLRDI  60
PVNQRGDAVC SMVYEAHARL KDPIYGCVAA IVSLQHQVSI LQAELAMTNA DNMSLKAQLS  120
DALSALSHAS PRAMDHVQGK MCTITQLSDA LTIFARASTR AAMDTEHANT YSFSTALDHG  180
YLEQPTSSLP HLLDCAELL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006843001.21e-88PREDICTED: LOB domain-containing protein 4
SwissprotQ8LBW35e-48LBD12_ARATH; LOB domain-containing protein 12
TrEMBLW1PAS41e-147W1PAS4_AMBTC; Uncharacterized protein
STRINGVIT_00s0125g00290.t012e-51(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-48LBD family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]